PDB entry 3tom

View 3tom on RCSB PDB site
Description: Crystal structure of an engineered cytochrome cb562 that forms 2D, Zn-mediated sheets
Class: metal binding protein
Keywords: four helix bundle, electron transfer, periplasmic space, METAL BINDING PROTEIN
Deposited on 2011-09-05, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (26-27)
      • engineered mutation (30)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (75-76)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3toma_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (26-27)
      • engineered mutation (30)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (75-76)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3tomb_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (26-27)
      • engineered mutation (30)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (75-76)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3tomc_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (26-27)
      • engineered mutation (30)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (75-76)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3tomd_
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tomA (A:)
    adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
    frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tomB (B:)
    adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
    frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tomC (C:)
    adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
    frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tomD (D:)
    adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
    frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr