PDB entry 3toh

View 3toh on RCSB PDB site
Description: HIV-1 Protease - Epoxydic Inhibitor Complex (pH 9 - Orthorombic Crystal form P212121)
Class: hydrolase/hydrolase inhibitor
Keywords: HIV PR, epoxide, in-crystal reaction, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-09-05, released 2012-08-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.178
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.05: d3toha_
  • Chain 'B':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.05: d3tohb_
  • Heterogens: 079, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tohA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tohB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf