PDB entry 3toh
View 3toh on RCSB PDB site
Description: HIV-1 Protease - Epoxydic Inhibitor Complex (pH 9 - Orthorombic Crystal form P212121)
Class: hydrolase/hydrolase inhibitor
Keywords: HIV PR, epoxide, in-crystal reaction, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-09-05, released
2012-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated
2012-08-15, with a file datestamp of
2012-08-10.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.178
AEROSPACI score: 0.87
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Gag-Pol polyprotein
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.03: d3toha_ - Chain 'B':
Compound: Gag-Pol polyprotein
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.03: d3tohb_ - Heterogens: 079, DMS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3tohA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3tohB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf