PDB entry 3tof
View 3tof on RCSB PDB site
Description: HIV-1 Protease - Epoxydic Inhibitor Complex (pH 6 - Orthorombic Crystal form P212121)
Class: hydrolase/hydrolase inhibitor
Keywords: HIV PR, epoxide, in-crystal reaction, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2011-09-05, released
2012-08-15
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-08-15, with a file datestamp of
2012-08-10.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.187
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Gag-Pol polyprotein
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.04: d3tofa_ - Chain 'B':
Compound: Gag-Pol polyprotein
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (94)
Domains in SCOPe 2.04: d3tofb_ - Heterogens: 076, ACT, DMS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3tofA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3tofB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf