PDB entry 3toe

View 3toe on RCSB PDB site
Description: Structure of Mth10b
Class: unknown function
Keywords: Sac10b family, alpha/beta mixed, homodimer, UNKNOWN FUNCTION
Deposited on 2011-09-05, released 2012-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA/RNA-binding protein Alba
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: albA, MTH_1483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3toea_
  • Chain 'B':
    Compound: DNA/RNA-binding protein Alba
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: albA, MTH_1483
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3toeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3toeA (A:)
    mseenvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiq
    ienidicteeiignegtatnvsaieiqlrkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3toeA (A:)
    nvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiqieni
    dicteeiignegtatnvsaieiqlrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3toeB (B:)
    mseenvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiq
    ienidicteeiignegtatnvsaieiqlrkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3toeB (B:)
    nvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiqieni
    dicteeiignegtatnvsaieiqlrk