PDB entry 3tnm

View 3tnm on RCSB PDB site
Description: Crystal structure of A32 Fab, an ADCC mediating anti-HIV-1 antibody
Class: immune system
Keywords: ADCC, NON-NEUTRALIZING, ANTI-HIV-1 ENV ANTIBODY A32, CD4i antibody, Fab, VIRAL GLYCOPROTEIN GP120, HIV-1 Env, IMMUNE SYSTEM
Deposited on 2011-09-01, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain of human anti-HIV-1 Env antibody A32
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNM (0-End)
  • Chain 'B':
    Compound: Fab light chain of human anti-HIV-1 Env antibody A32
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNM
    Domains in SCOPe 2.07: d3tnmb1, d3tnmb2
  • Chain 'H':
    Compound: Fab heavy chain of human anti-HIV-1 Env antibody A32
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNM (0-End)
  • Chain 'L':
    Compound: Fab light chain of human anti-HIV-1 Env antibody A32
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TNM
    Domains in SCOPe 2.07: d3tnml1, d3tnml2
  • Heterogens: ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tnmB (B:)
    qsvltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgv
    pdrfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnmB (B:)
    vltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgvpd
    rfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3tnmL (L:)
    qsvltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgv
    pdrfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnmL (L:)
    vltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgvpd
    rfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvap