PDB entry 3tnl

View 3tnl on RCSB PDB site
Description: 1.45 Angstrom Crystal Structure of Shikimate 5-dehydrogenase from Listeria monocytogenes in Complex with Shikimate and NAD.
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, NAD(P)-binding Rossmann-fold domain, Shikimate 5-dehydrogenase, NAD, OXIDOREDUCTASE
Deposited on 2011-09-01, released 2011-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.15
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tnla1, d3tnla2
  • Chain 'B':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tnlb1, d3tnlb2
  • Chain 'C':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tnlc1, d3tnlc2
  • Chain 'D':
    Compound: Shikimate dehydrogenase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroE, lmo0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tnld1, d3tnld2
  • Heterogens: NAD, SKM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tnlA (A:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnlA (A:)
    kiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfr
    amnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralke
    aghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktdc
    kaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykpt
    ktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tnlB (B:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnlB (B:)
    nkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgf
    ramnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralk
    eaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktd
    ckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykp
    tktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tnlC (C:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnlC (C:)
    nkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgf
    ramnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralk
    eaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktd
    ckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykp
    tktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tnlD (D:)
    mhhhhhhssgvdlgtenlyfqsnamtnkiteritghteligliatpirhslsptmhneaf
    aklgldyvylafevgdkelkdvvqgframnlrgwnvsmpnktnihkyldklspaaelvga
    vntvvnddgvltghitdgtgymralkeaghdiigkkmticgaggaataiciqaaldgvke
    isifnrkddfyanaektvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkp
    fegetllpsadmlrpelivsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiw
    thkempvdyikeilf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tnlD (D:)
    kiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfr
    amnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghitdgtgymralke
    aghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaektvekinsktdc
    kaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpelivsdvvykpt
    ktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf