PDB entry 3tn2

View 3tn2 on RCSB PDB site
Description: structure analysis of MIP1-beta P8A
Class: cytokine
Keywords: cytokine
Deposited on 2011-09-01, released 2012-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-c motif chemokine 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13236 (0-67)
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3tn2a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tn2A (A:)
    apmgsdpataccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
    eyvydlel