PDB entry 3tn1

View 3tn1 on RCSB PDB site
Description: Structure analysis of the Mip1a P8A mutant
Class: cytokine
Keywords: cytokine
Deposited on 2011-09-01, released 2012-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (1-67)
      • expression tag (0)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d3tn1a1, d3tn1a2
  • Chain 'B':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (1-67)
      • expression tag (0)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d3tn1b1, d3tn1b2
  • Chain 'C':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (Start-67)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d3tn1c_
  • Chain 'D':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (1-67)
      • expression tag (0)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d3tn1d1, d3tn1d2
  • Chain 'E':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (1-67)
      • expression tag (0)
      • engineered mutation (6)
    Domains in SCOPe 2.06: d3tn1e1, d3tn1e2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tn1A (A:)
    alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tn1B (B:)
    alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tn1C (C:)
    alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tn1C (C:)
    adtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyvs
    dlels
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tn1D (D:)
    alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tn1E (E:)
    alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlels