PDB entry 3tmt

View 3tmt on RCSB PDB site
Description: IrisFP, distorted chromophore
Class: Fluorescent Protein
Keywords: Beta-can, Fluorescent protein
Deposited on 2011-08-31, released 2011-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.295
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • expression tag (5)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.07: d3tmta1, d3tmta2
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.07: d3tmtb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.07: d3tmtc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.07: d3tmtd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tmtA (A:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmtA (A:)
    hmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltt
    afhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvr
    fhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyka
    kekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tmtB (B:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmtB (B:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tmtC (C:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmtC (C:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
    kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tmtD (D:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmtD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn