PDB entry 3tmr

View 3tmr on RCSB PDB site
Description: IrisFP, planar chromophore
Class: Fluorescent Protein
Keywords: Beta-can, Fluorescent protein
Deposited on 2011-08-31, released 2011-11-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • expression tag (5)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.03: d3tmra_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.03: d3tmrb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.03: d3tmrc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.03: d3tmrd_
  • Heterogens: SO4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tmrA (A:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmrA (A:)
    hmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltt
    afhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvr
    fhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyka
    kekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tmrB (B:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmrB (B:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tmrC (C:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmrC (C:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tmrD (D:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmrD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn