PDB entry 3tmk

View 3tmk on RCSB PDB site
Description: crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor tp5a at 2.0 a resolution: implications for catalysis and azt activation
Class: kinase
Keywords: kinase, phosphotransferase
Deposited on 1998-01-26, released 1999-02-16
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmka_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmkb_
  • Chain 'C':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmkc_
  • Chain 'D':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmkd_
  • Chain 'E':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmke_
  • Chain 'F':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmkf_
  • Chain 'G':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmkg_
  • Chain 'H':
    Compound: thymidylate kinase
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3tmkh_
  • Heterogens: T5A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tmkA (A:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tmkB (B:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tmkC (C:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmkC (C:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdderyetvkfqekvkqtfmklldkeirkgdesitivdvtnkgiqe
    vealiwqivepvlsthidhdkfsff
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tmkD (D:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmkD (D:)
    grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
    qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
    llkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesitiv
    dvtnkgiqevealiwqivepvlsthidhdkfsff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tmkE (E:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmkE (E:)
    mgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqls
    dqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdv
    gllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesiti
    vdvtnkgiqevealiwqivepvlsthidhdkfsff
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tmkF (F:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3tmkG (G:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmkG (G:)
    mgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqls
    dqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdv
    gllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesiti
    vdvtnkgiqevealiwqivepvlsthidhdkfsff
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3tmkH (H:)
    mmgrgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfql
    sdqaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpd
    vgllkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesit
    ivdvtnkgiqevealiwqivepvlsthidhdkfsff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tmkH (H:)
    grgkliliegldrtgkttqcnilykklqpnckllkfperstrigglineyltddsfqlsd
    qaihllfsanrweivdkikkdllegknivmdryvysgvaysaakgtngmdldwclqpdvg
    llkpdltlflstqdvdnnaeksgfgderyetvkfqekvkqtfmklldkeirkgdesitiv
    dvtnkgiqevealiwqivepvlsthidhdkfsff