PDB entry 3tm0

View 3tm0 on RCSB PDB site
Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa AMPPNP Butirosin A Complex
Class: transferase/antibiotic
Keywords: protein kinase, phosphorylation, TRANSFERASE-ANTIBIOTIC complex
Deposited on 2011-08-30, released 2011-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside 3'-phosphotransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: aph(3')-IIIa, aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3tm0a_
  • Heterogens: ANP, B31, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3tm0A (A:)
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf