PDB entry 3tlr
View 3tlr on RCSB PDB site
Description: Crystal Structure of the tetrameric Beta-2 microglobulin DIMC20 mutant
Class: immune system
Keywords: Immunoglobulin-like fold, MHC class I, Light chain, IMMUNE SYSTEM
Deposited on
2011-08-30, released
2012-09-05
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-09-05, with a file datestamp of
2012-08-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.228
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Beta-2-microglobulin
Species: Homo sapiens [TaxId:9606]
Gene: B2M, CDABP0092, HDCMA22P
Database cross-references and differences (RAF-indexed):
- Uniprot P61769 (1-99)
- expression tag (0)
- engineered mutation (20)
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Homo sapiens [TaxId:9606]
Gene: B2M, CDABP0092, HDCMA22P
Database cross-references and differences (RAF-indexed):
- Uniprot P61769 (1-99)
- expression tag (0)
- engineered mutation (20)
Domains in SCOPe 2.02: d3tlrb_ - Chain 'C':
Compound: Beta-2-microglobulin
Species: Homo sapiens [TaxId:9606]
Gene: B2M, CDABP0092, HDCMA22P
Database cross-references and differences (RAF-indexed):
- Uniprot P61769 (1-99)
- expression tag (0)
- engineered mutation (20)
Domains in SCOPe 2.02: d3tlrc_ - Chain 'D':
Compound: Beta-2-microglobulin
Species: Homo sapiens [TaxId:9606]
Gene: B2M, CDABP0092, HDCMA22P
Database cross-references and differences (RAF-indexed):
- Uniprot P61769 (1-99)
- expression tag (0)
- engineered mutation (20)
- Heterogens: CD, NA, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3tlrB (B:)
miqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3tlrC (C:)
miqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
- Chain 'D':
No sequence available.