PDB entry 3tlr

View 3tlr on RCSB PDB site
Description: Crystal Structure of the tetrameric Beta-2 microglobulin DIMC20 mutant
Class: immune system
Keywords: Immunoglobulin-like fold, MHC class I, Light chain, IMMUNE SYSTEM
Deposited on 2011-08-30, released 2012-09-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.228
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
      • engineered mutation (20)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
      • engineered mutation (20)
    Domains in SCOPe 2.02: d3tlrb_
  • Chain 'C':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
      • engineered mutation (20)
    Domains in SCOPe 2.02: d3tlrc_
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-99)
      • expression tag (0)
      • engineered mutation (20)
  • Heterogens: CD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tlrB (B:)
    miqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tlrC (C:)
    miqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

  • Chain 'D':
    No sequence available.