PDB entry 3tlh

View 3tlh on RCSB PDB site
Description: structural studies of hiv and fiv proteases complexed withan efficient inhibitor of fiv pr
Class: hydrolase/hydrolase inhibitor
Keywords: hiv protease, hydrolase-hydrolase inhibitor complex
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protease)
    Species: Human immunodeficiency virus type 1 (CLONE 12) [TaxId:11679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tlha_
  • Heterogens: 3TL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tlhA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf