PDB entry 3tlh

View 3tlh on RCSB PDB site
Description: structural studies of hiv and fiv proteases complexed withan efficient inhibitor of fiv pr
Deposited on 1998-12-03, released 1998-12-09
The last revision prior to the SCOP 1.65 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d3tlha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3tlhA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf