PDB entry 3tkt

View 3tkt on RCSB PDB site
Description: Crystal structure of CYP108D1 from Novosphingobium aromaticivorans DSM12444
Class: Oxidoreductase
Keywords: Cytochrome P450 fold, aromatic hydrocarbon binding of P450 enzyme, Oxidoreductase
Deposited on 2011-08-29, released 2012-02-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_3162
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tkta_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tktA (A:)
    mgsshhhhhhssglvprgshmdsipmvpaevgravidpksygtweplldrfdalraeapv
    akvvapddehepfwlvssfdgvmkaskdnatflnnpkstvftlrvgemmakaitggsphl
    veslvqmdapkhpklrrltqdwfmpknlarldgeirkianeaidrmlgageegdfmalva
    apyplhvvmqilgvppedepkmlfltqqmfggqdedmnksglkdlppeqisqivagavae
    feryfaglaaerrrnptddvatvianavvdgepmsdrdtagyyiitasaghdttsassag
    aalalardpdlfarvkadrnllpgiveeairwttpvqhfmrtaatdtelcgqkiaagdwl
    mlnyvaanhdpaqfpeprkfdptrpanrhlafgagshqclglhlarlemrvlldvlldrv
    dslelagepkrvnstfvggfkslpmrwkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tktA (A:)
    ipmvpaevgravidpksygtweplldrfdalraeapvakvvapddehepfwlvssfdgvm
    kaskdnatflnnpkstvftlrvgemmakaitggsphlveslvqmdapkhpklrrltqdwf
    mpknlarldgeirkianeaidrmlgageegdfmalvaapyplhvvmqilgvppedepkml
    fltqqmfggqisqivagavaeferyfaglaaerrrnptddvatvianavvdgepmsdrdt
    agyyiitasaghdttsassagaalalardpdlfarvkadrnllpgiveeairwttpvqhf
    mrtaatdtelcgqkiaagdwlmlnyvaanhdpaqfpeprkfdptrpanrhlafgagshqc
    lglhlarlemrvlldvlldrvdslelagepkrvnstfvggfkslpmrwkaa