PDB entry 3tks

View 3tks on RCSB PDB site
Description: Crystal structure of full-length human peroxiredoxin 4 in three different redox states
Class: oxidoreductase
Keywords: Trx fold, peroxiredoxin, OXIDOREDUCTASE
Deposited on 2011-08-28, released 2011-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxiredoxin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tksa_
  • Chain 'B':
    Compound: Peroxiredoxin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tksb_
  • Chain 'C':
    Compound: Peroxiredoxin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tksc_
  • Chain 'D':
    Compound: Peroxiredoxin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tksd_
  • Chain 'E':
    Compound: Peroxiredoxin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PRDX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tkse_
  • Heterogens: PER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tksA (A:)
    mrgshhhhhhgsweteerprtreeechfyaggqvypgeasrvsvadhslhlskakiskpa
    pywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsintev
    vacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglfii
    ddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagklk
    yfdkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tksA (A:)
    hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
    leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
    sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
    tiipdpagklkyfdkln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tksB (B:)
    mrgshhhhhhgsweteerprtreeechfyaggqvypgeasrvsvadhslhlskakiskpa
    pywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsintev
    vacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglfii
    ddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagklk
    yfdkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tksB (B:)
    hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
    leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
    sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
    tiipdpagklkyfdkln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tksC (C:)
    mrgshhhhhhgsweteerprtreeechfyaggqvypgeasrvsvadhslhlskakiskpa
    pywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsintev
    vacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglfii
    ddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagklk
    yfdkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tksC (C:)
    hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
    leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
    sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
    tiipdpagklkyfdkln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tksD (D:)
    mrgshhhhhhgsweteerprtreeechfyaggqvypgeasrvsvadhslhlskakiskpa
    pywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsintev
    vacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglfii
    ddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagklk
    yfdkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tksD (D:)
    hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
    leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
    sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
    tiipdpagklkyfdkln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tksE (E:)
    mrgshhhhhhgsweteerprtreeechfyaggqvypgeasrvsvadhslhlskakiskpa
    pywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdrleefrsintev
    vacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyledsghtlrglfii
    ddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsetiipdpagklk
    yfdkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tksE (E:)
    hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
    leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
    sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
    tiipdpagklkyfdkln