PDB entry 3tkm

View 3tkm on RCSB PDB site
Description: Crystal structure PPAR delta binding GW0742
Class: transcription/transcription activator
Keywords: nuclear receptor, TRANSCRIPTION, TRANSCRIPTION-TRANSCRIPTION ACTIVATOR complex
Deposited on 2011-08-27, released 2012-07-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (4-274)
      • expression tag (0-3)
    Domains in SCOPe 2.02: d3tkma_
  • Heterogens: GW0, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tkmA (A:)
    gshmqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekgl
    vwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygv
    heaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnaleldds
    dlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadl
    rqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkmA (A:)
    gshmqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekgl
    vwglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaif
    amlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalf
    iaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvt
    ehaqmmqrikktetetslhpllqeiykdmy