PDB entry 3tkl

View 3tkl on RCSB PDB site
Description: Crystal structure of the GTP-bound Rab1a in complex with the coiled-coil domain of LidA from Legionella pneumophila
Class: protein transport/protein binding
Keywords: Vesicle trafficking, PROTEIN TRANSPORT-PROTEIN BINDING complex
Deposited on 2011-08-27, released 2012-06-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3tkla_
  • Chain 'B':
    Compound: LidA protein, substrate of the Dot/Icm system
    Species: Legionella pneumophila [TaxId:400673]
    Gene: lidA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tklA (A:)
    gplgsmssmnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtiel
    dgktiklqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryase
    nvnkllvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkr
    mgpgataggaeksnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tklA (A:)
    peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
    dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
    cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
    

  • Chain 'B':
    No sequence available.