PDB entry 3tkg

View 3tkg on RCSB PDB site
Description: crystal structure of HIV model protease precursor/saquinavir complex
Class: hydrolase/hydrolase inhibitor
Keywords: Hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-08-26, released 2012-04-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.163
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (1-102)
      • conflict (10)
      • conflict (36)
      • conflict (66)
      • conflict (70)
      • conflict (98)
    Domains in SCOPe 2.04: d3tkga_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (Start-102)
      • conflict (10)
      • conflict (36)
      • conflict (66)
      • conflict (70)
      • conflict (98)
    Domains in SCOPe 2.04: d3tkgb_
  • Chain 'C':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (1-102)
      • conflict (10)
      • conflict (36)
      • conflict (66)
      • conflict (70)
      • conflict (98)
    Domains in SCOPe 2.04: d3tkgc_
  • Chain 'D':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (Start-102)
      • conflict (10)
      • conflict (36)
      • conflict (66)
      • conflict (70)
      • conflict (98)
    Domains in SCOPe 2.04: d3tkgd_
  • Heterogens: CL, GOL, ROC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tkgA (A:)
    sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
    rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tkgB (B:)
    sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
    rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkgB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tkgC (C:)
    sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
    rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tkgD (D:)
    sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
    rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkgD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf