PDB entry 3tkc

View 3tkc on RCSB PDB site
Description: Design, Synthesis, Evaluation and Structure of Vitamin D Analogues with Furan Side Chains
Class: transcription
Keywords: alpha-helical sandwich, transcription, calcitriol, phosphorylation, nucleus
Deposited on 2011-08-26, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.159
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tkca_
  • Heterogens: FMV, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tkcA (A:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
    hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
    gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
    aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
    ecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tkcA (A:)
    slrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlph
    ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
    nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
    alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
    csmkltplvlevfg