PDB entry 3tjv

View 3tjv on RCSB PDB site
Description: Crystal structure of human granzyme H with a peptidyl substrate
Class: hydrolase
Keywords: serine protease, Cytolysis, HYDROLASE SUBSTRATE, HYDROLASE
Deposited on 2011-08-25, released 2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Granzyme H
    Species: Homo sapiens [TaxId:9606]
    Gene: GZMH, CGL2, CTSGL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20718 (0-End)
      • engineered mutation (87)
    Domains in SCOPe 2.01: d3tjva_
  • Chain 'B':
    Compound: ptsyagddsg
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3TJV (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tjvA (A:)
    iiggheakphsrpymafvqflqeksrkrcggilvrkdfvltaahcqgssinvtlgahnik
    eqertqqfipvkrpiphpaynpknfsnnimllqlerkakwttavrplrlpsskaqvkpgq
    lcsvagwgyvsmstlattlqevlltvqkdcqcerlfhgnysrateicvgdpkktqtgfkg
    dsggplvckdvaqgilsygnkkgtppgvyikvshflpwikrtmkrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tjvA (A:)
    iiggheakphsrpymafvqflqeksrkrcggilvrkdfvltaahcqgssinvtlgahnik
    eqertqqfipvkrpiphpaynpknfsnnimllqlerkakwttavrplrlpsskaqvkpgq
    lcsvagwgyvsmstlattlqevlltvqkdcqcerlfhgnysrateicvgdpkktqtgfkg
    dsggplvckdvaqgilsygnkkgtppgvyikvshflpwikrtmkr
    

  • Chain 'B':
    No sequence available.