PDB entry 3tj2

View 3tj2 on RCSB PDB site
Description: Structure of a novel submicromolar MDM2 inhibitor
Class: protein binding/inhibitor
Keywords: cell cycle control, DNA repair, oncoprotein, p53, nucleus, PROTEIN BINDING-INHIBITOR complex
Deposited on 2011-08-23, released 2012-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tj2a_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tj2c_
  • Heterogens: TJ2, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tj2A (A:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tj2A (A:)
    aseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsnd
    llgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tj2C (C:)
    mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tj2C (C:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
    sndllgdlfgvpsfsvkehrkiytmiyrnlvvv