PDB entry 3tis

View 3tis on RCSB PDB site
Description: Crystal structures of yrdA from Escherichia coli, a homologous protein of gamma-class carbonic anhydrases, show possible allosteric conformations
Class: transferase
Keywords: Carbonic anhydrase (CA), ZN biding, Phosphate binding, TRANSFERASE
Deposited on 2011-08-21, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9 (0-End)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tisa_
  • Chain 'B':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tisb_
  • Chain 'C':
    Compound: Protein YrdA
    Species: Escherichia coli [TaxId:83333]
    Gene: yrdA, b3279, JW5710
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9W9
      • engineered mutation (4)
    Domains in SCOPe 2.07: d3tisc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tisA (A:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tisA (A:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthksgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddvmiga
    gslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tisB (B:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tisB (B:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
    migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tisC (C:)
    sdvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniq
    dgsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaivedd
    vmigagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqgnq
    tqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tisC (C:)
    dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
    gsmlhvthkgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddvmigags
    lvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldq