PDB entry 3tii

View 3tii on RCSB PDB site
Description: Tubulin tyrosine ligase
Class: ligase
Keywords: ATP-grasp, ligase, tubulin, tyrosination
Deposited on 2011-08-20, released 2011-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.254
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ttl protein
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: TTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9ULH4 (4-379)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3tiia1, d3tiia2, d3tiia3
  • Chain 'B':
    Compound: Ttl protein
    Species: Xenopus (Silurana) tropicalis [TaxId:8364]
    Gene: TTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9ULH4 (4-379)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3tiib1, d3tiib2, d3tiib3
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tiiA (A:)
    gsftytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepg
    lvqlvnyyrgadklcrkaslvkliktspeltetctwfpesyviyptnektpamrarnglp
    dlanaprtdereefrssfnkkkeneegnvwiaksssgakgegilissdatelldfidnqg
    qvhviqkylesplllepghrkfdirswvlvdnqyniylyregvlrtssepysdtnfqdmt
    shltnhciqkehsknygryeegnemffeefnqylvtslninlensilcqikeiirvclsc
    lepaistkylpyhsfqlfgfdfmvdknlkvwlievngapacaqklyaelckgivdlaiss
    vfplneenhkptednvfikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tiiA (A:)
    gsftytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepg
    lvqlvnyyrgadklcrkaslvkliktspeltctwfpesyviyptdereefrssfnkkken
    eegnvwiaksssgilissdatelldfidnqgqvhviqkylesplllepghrkfdirswvl
    vdnqyniylyregvlrtssepynemffeefnqylvtslninlensilcqikeiirvclsc
    lepaistkylpyhsfqlfgfdfmvdknlkvwlievngapacaqklyaelckgivdlaiss
    vfplnnvfikl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tiiB (B:)
    gsftytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepg
    lvqlvnyyrgadklcrkaslvkliktspeltetctwfpesyviyptnektpamrarnglp
    dlanaprtdereefrssfnkkkeneegnvwiaksssgakgegilissdatelldfidnqg
    qvhviqkylesplllepghrkfdirswvlvdnqyniylyregvlrtssepysdtnfqdmt
    shltnhciqkehsknygryeegnemffeefnqylvtslninlensilcqikeiirvclsc
    lepaistkylpyhsfqlfgfdfmvdknlkvwlievngapacaqklyaelckgivdlaiss
    vfplneenhkptednvfikl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tiiB (B:)
    gsftytfvvrdenstvyaevakillasgqwkrlkrdnpkfnlmlgernrlpfgrlghepg
    lvqlvnyyrgadklcrkaslvkliktspeltetctwfpesyviypdereefrssfnkkke
    neegnvwiaksssegilissdatelldfidnqgqvhviqkylesplllepghrkfdirsw
    vlvdnqyniylyregvlrtssepynemffeefnqylvtslninlensilcqikeiirvcl
    sclepaistkylpyhsfqlfgfdfmvdknlkvwlievngapacaqklyaelckgivdlai
    ssvfplnnvfikl