PDB entry 3ti8

View 3ti8 on RCSB PDB site
Description: Crystal structure of influenza A virus neuraminidase N5 complexed with laninamivir
Class: hydrolase/hydrolase inhibitor
Keywords: 6-BLADED BETA-PROPELLER, CALCIUM BINDING, GLYCOSYLATION, antiviral, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-08-20, released 2011-11-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.129
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385582]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ti8a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:385582]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ti8b_
  • Heterogens: CA, NAG, LNV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ti8A (A:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ti8A (A:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ti8B (B:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ti8B (B:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidk