PDB entry 3th9

View 3th9 on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant Q7K V32I L63I with a cyclic sulfonamide inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: enzyme inhibition, aspartic protease, HIV/AIDS, conformational change, Amprenavir, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-08-18, released 2011-09-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.181
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Gag-Pol polyprotein
  Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6F2 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
  Domains in SCOPe 2.04: d3th9a_
• Chain 'B':
  Compound: Gag-Pol polyprotein
  Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6F2 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
  Domains in SCOPe 2.04: d3th9b_
• Heterogens: 9Y9, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3th9A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3th9B (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieicghkaigtvlvgptpvniigrnlltqigctlnf