PDB entry 3th8

View 3th8 on RCSB PDB site
Description: Structure of E. coli undecaprenyl diphosphate synthase complexed with BPH-1063
Class: transferase/transferase inhibitor
Keywords: all helices, prenyl transferase, farneyl diphosphate binding, Isopentenyl diphosphate binding, prenylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-08-18, released 2012-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: uppS, ispU, rth, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3th8a_
  • Chain 'B':
    Compound: undecaprenyl pyrophosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: uppS, ispU, rth, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3th8b_
  • Heterogens: TH9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3th8A (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3th8A (A:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsvwald
    sevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivqg
    vrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayael
    yftdvlwpdfdeqdfegalnafanr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3th8B (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3th8B (B:)
    pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafmel
    fvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggr
    wdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwq
    iayaelyftdvlwpdfdeqdfegalnafanr