PDB entry 3tgm

View 3tgm on RCSB PDB site
Description: X-Ray Crystal Structure of Human Heme Oxygenase-1 in Complex with 1-(1H-imidazol-1-yl)-4,4-diphenyl-2 butanone
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Alpha helix, oxidoreductase, heme, microsomes, oxidoreductase-oxidoreductase inhibitor complex
Deposited on 2011-08-17, released 2012-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tgma_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tgmb_
  • Heterogens: HEM, 3TG, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tgmA (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgmA (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tgmB (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgmB (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellthd