PDB entry 3tgl

View 3tgl on RCSB PDB site
Description: structure and molecular model refinement of rhizomucor miehei triacylglyceride lipase: a case study of the use of simulated annealing in partial model refinement
Deposited on 1991-07-29, released 1993-07-15
The last revision prior to the SCOP 1.57 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.129
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3tgl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tgl_ (-)
    giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
    mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
    tvldqfkqypsykvavtghslggatvllcaldlyqreeglsssnlflytqgqprvgdpaf
    anyvvstgipyrrtvnerdivphlppaafgflhageeywitdnspetvqvctsdletsdc
    snsivpftsvldhlsyfgintglct