PDB entry 3tgk

View 3tgk on RCSB PDB site
Description: trypsinogen mutant d194n and deletion of ile 16-val 17 complexed with bovine pancreatic trypsin inhibitor (bpti)
Class: hydrolase/ hydrolase inhibitor
Keywords: serine protease, complex (serine protease/inhibitor), hydrolase/ hydrolase inhibitor complex
Deposited on 1998-07-19, released 2001-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: trypsin II, anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (Start-221)
      • engineered (178)
    Domains in SCOPe 2.05: d3tgke_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tgki_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tgkE (E:)
    eafpvddddkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlge
    hninvlegneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapa
    gtqclisgwgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkds
    cqgnsggpvvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgkE (E:)
    kggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvlegn
    eqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisgw
    gnvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgnsggpvvcnge
    lqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3tgkI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggaig
    pwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgkI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg