PDB entry 3tgj

View 3tgj on RCSB PDB site
Description: s195a trypsinogen complexed with bovine pancreatic trypsin inhibitor (bpti)
Class: complex (serine protease/inhibitor)
Keywords: complex (serine protease/inhibitor)
Deposited on 1998-07-16, released 1998-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (Start-232)
      • engineered (186)
    Domains in SCOPe 2.05: d3tgje_
  • Chain 'I':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3tgji_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tgjE (E:)
    eafpvddddkivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrl
    gehninvlegneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpssca
    pagtqclisgwgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggk
    dscqgdaggpvvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgjE (E:)
    kivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvle
    gneqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclis
    gwgpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggpvvcngelq
    givswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3tgjI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggaig
    pwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgjI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg