PDB entry 3tgi

View 3tgi on RCSB PDB site
Description: wild-type rat anionic trypsin complexed with bovine pancreatic trypsin inhibitor (bpti)
Class: complex (serine protease/inhibitor)
Keywords: complex (serine protease/inhibitor)
Deposited on 1998-07-15, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tgie_
  • Chain 'I':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tgii_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tgiE (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3tgiI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcggaig
    pwenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tgiI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg