PDB entry 3tgf

View 3tgf on RCSB PDB site
Description: the solution structure of human transforming growth factor alpha
Deposited on 1991-01-23, released 1993-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3tgf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tgf_ (-)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla