PDB entry 3tgd

View 3tgd on RCSB PDB site
Description: Crystal structure of the human ubiquitin-conjugating enzyme (E2) UbcH5b
Class: ligase
Keywords: UBC-like, ubiqutin-conjugating enzyme, ubiquitin binding, LIGASE
Deposited on 2011-08-17, released 2011-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-conjugating enzyme e2 d2
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC4, UBC5B, UBCH4, UBCH5B, UBE2D2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62837 (5-151)
    • expression tag (0-4)
  Domains in SCOPe 2.06: d3tgda1, d3tgda2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3tgdA (A:)
  gamgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
  fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
  ddplvpeiariyktdrekynriarewtqkyam