PDB entry 3tgd

View 3tgd on RCSB PDB site
Description: Crystal structure of the human ubiquitin-conjugating enzyme (E2) UbcH5b
Class: ligase
Keywords: UBC-like, ubiqutin-conjugating enzyme, ubiquitin binding, LIGASE
Deposited on 2011-08-17, released 2011-08-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC4, UBC5B, UBCH4, UBCH5B, UBE2D2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62837 (5-151)
      • expression tag (0-4)
    Domains in SCOPe 2.02: d3tgda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tgdA (A:)
    gamgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
    fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
    ddplvpeiariyktdrekynriarewtqkyam