PDB entry 3tg7

View 3tg7 on RCSB PDB site
Description: Crystal structure of Adenovirus serotype 5 hexon at 1.6A resolution
Class: viral protein
Keywords: Adenovirus structural protein, with new finding featuring possible binding to human coagulation factor X, VIRAL PROTEIN
Deposited on 2011-08-17, released 2011-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.186
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hexon protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3tg7a1, d3tg7a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tg7A (A:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tg7A (A:)
    pqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrltlr
    fipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynalapk
    gapnpcewdethvfgqapysginitkegiqigvtpkyadktfqpepqigesqwyeteinh
    aagrvlkkttpmkpcygsyakptnenggqgilvlesqvemqffstteltpkvvlysedvd
    ietpdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqa
    sqlnavvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpn
    ycfplggvintetltkvkpgwekdatefsdkneirvgnnfameinlnanlwrnflysnia
    lylpdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhh
    rnaglryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslg
    ndlrvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipa
    natnvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtf
    kkvaitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigy
    qgfyipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmre
    gqaypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansa
    haldmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa