PDB entry 3tg0

View 3tg0 on RCSB PDB site
Description: E. coli alkaline phosphatase with bound inorganic phosphate
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-08-16, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.149
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tg0a_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tg0b_
  • Chain 'C':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tg0c_
  • Chain 'D':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3tg0d_
  • Heterogens: ZN, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tg0A (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tg0A (A:)
    nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
    ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
    hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
    gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
    anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
    llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
    vvgltdqtdlfytmkaalgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tg0B (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tg0B (B:)
    nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
    ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
    hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
    gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
    anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
    llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
    vvgltdqtdlfytmkaalgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tg0C (C:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tg0C (C:)
    nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
    ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
    hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
    gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
    anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
    llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
    vvgltdqtdlfytmkaalgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tg0D (D:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tg0D (D:)
    vlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnya
    egaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdih
    ekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalek
    ggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslns
    vteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdk
    aiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvi
    vtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygph
    aanvvgltdqtdlfytmkaalgl