PDB entry 3tfb

View 3tfb on RCSB PDB site
Description: Transthyretin natural mutant A25T
Class: hormone binding protein
Keywords: Transthyretin, Immunoglobulin-like, Transport Protein, extracellular, HORMONE-BINDING PROTEIN, HORMONE BINDING PROTEIN
Deposited on 2011-08-15, released 2011-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered mutation (15)
    Domains in SCOPe 2.06: d3tfba_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.06: d3tfbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tfbA (A:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tfbB (B:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tfbB (B:)
    cplmvkvldavrgsptinvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgrrytiaallspysysttavvtn