PDB entry 3tf4

View 3tf4 on RCSB PDB site
Description: endo/exocellulase:cellotriose from thermomonospora
Class: glycosyl hydrolase
Keywords: glycosyl hydrolase
Deposited on 1997-05-30, released 1997-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: BAMH1-PST1 FRAGMENT OF T. FUSC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tf4a1, d3tf4a2
  • Chain 'B':
    Compound: t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain
    Species: THERMOBIFIDA FUSCA [TaxId:2021]
    Gene: BAMH1-PST1 FRAGMENT OF T. FUSC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tf4b1, d3tf4b2
  • Heterogens: BGC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tf4A (A:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tf4B (B:)
    epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
    kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
    gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
    hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
    dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
    pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
    ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
    vanevatdynagfssalamlveeyggtpladfppteepdgpeifveaqintpgttfteik
    amirnqsgwparmldkgtfrywftldegvdpaditvssaynqcatpedvhhvsgdlyyve
    idctgekifpggqsehrrevqfriaggpgwdpsndwsfqgignelapapyivlyddgvpv
    wgtap