PDB entry 3tea

View 3tea on RCSB PDB site
Description: Crystal structure of Arthrobacter sp. strain su 4-hydroxybenzoyl CoA thioesterase double mutant Q58E/E73A complexed with 4-hydroxyphenacyl CoA
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hotdog, hydrolase, thioesterase, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2011-08-12, released 2012-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (57)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d3teaa_
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Arthrobacter sp. [TaxId:1667]
    Gene: fcbC, fcbC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04416 (Start-150)
      • engineered mutation (57)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d3teab_
  • Heterogens: 4CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3teaA (A:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrerw
    glvhggaycalaamlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3teaA (A:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrerwglvhggaycal
    aamlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3teaB (B:)
    mhrtsngshatggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrerw
    glvhggaycalaamlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihags
    ttwfwdvslrddagrlcavssmsiavrprrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3teaB (B:)
    ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrerwglvhggaycal
    aamlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
    dagrlcavssmsiavrprrd