PDB entry 3tcz

View 3tcz on RCSB PDB site
Description: Human Pin1 bound to cis peptidomimetic inhibitor
Class: ISOMERASE/Inhibitor
Keywords: PPIase domain, WW domain, Peptidyl-prolyl isomerase, ISOMERASE-Inhibitor complex
Deposited on 2011-08-09, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.228
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (0-157)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3tcza1, d3tcza2
  • Heterogens: R2Z, PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tczA (A:)
    klppgwekamsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvrcshllvkhs
    qsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgaf
    srgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tczA (A:)
    klppgwekamsrssgrvyyfnhitnasqwerpseparvrcshllvkhsqsrrpsswrqek
    itrtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfeda
    sfalrtgemsgpvftdsgihiilrte