PDB entry 3tct

View 3tct on RCSB PDB site
Description: Structure of wild-type TTR in complex with tafamidis
Class: hormone, binding protein
Keywords: AMYLOID, AMYLOIDOSIS, DISEASE MUTATION, GAMMA-CARBOXYGLUTAMIC ACID, GLYCOPROTEIN, HORMONE, NEUROPATHY, SECRETED, THYROID HORMONE, TRANSPORT, Kinetic Stabilizer, Inhibition of the Amyloid Cascade, BINDING PROTEIN
Deposited on 2011-08-09, released 2012-05-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.163
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tcta_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tctb_
  • Heterogens: 3MI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tctA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tctA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tctB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tctB (B:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn