PDB entry 3tcl

View 3tcl on RCSB PDB site
Description: Crystal Structure of HIV-1 Neutralizing Antibody CH04
Class: immune system
Keywords: Ig, Immunoglobulin, IMMUNE SYSTEM
Deposited on 2011-08-09, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CH04 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TCL (0-End)
  • Chain 'B':
    Compound: CH04 Light Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TCL (0-End)
    Domains in SCOPe 2.07: d3tclb1, d3tclb2
  • Chain 'H':
    Compound: CH04 Heavy Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TCL (0-End)
  • Chain 'L':
    Compound: CH04 Light Chain Fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3TCL (0-End)
    Domains in SCOPe 2.07: d3tcll1, d3tcll2
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tclB (B:)
    eivltqspdtlslspgeratlscrasqsvhsryfawyqhkpgqpprlliyggstratgip
    nrfsaggsgtqftltvnrleaedfavyycqqygrspytfgqgtkveirrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tclB (B:)
    eivltqspdtlslspgeratlscrasqsvhsryfawyqhkpgqpprlliyggstratgip
    nrfsaggsgtqftltvnrleaedfavyycqqygrspytfgqgtkveirrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3tclL (L:)
    eivltqspdtlslspgeratlscrasqsvhsryfawyqhkpgqpprlliyggstratgip
    nrfsaggsgtqftltvnrleaedfavyycqqygrspytfgqgtkveirrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tclL (L:)
    eivltqspdtlslspgeratlscrasqsvhsryfawyqhkpgqpprlliyggstratgip
    nrfsaggsgtqftltvnrleaedfavyycqqygrspytfgqgtkveirrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge