SCOPe 2.01: Structural Classification of Proteins

PDB entry 3tcg

View 3tcg on RCSB PDB site
Description: Crystal structure of E. coli OppA complexed with the tripeptide KGE
Class: protein transport
Keywords: peptide-binding domain, PROTEIN TRANSPORT, Peptide-binding protein, peptide transport, ABC transporter
Deposited on 2011-08-09, released 2011-10-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcga_
Chain 'B':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcgb_
Chain 'C':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcgc_
Chain 'D':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcgd_
Chain 'E':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcge_
Chain 'F':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcgf_
Chain 'G':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcgg_
Chain 'H':
Compound: periplasmic oligopeptide-binding protein
Species: Escherichia coli [TaxId:83333]
Gene: b1243, JW1235, oppA
Database cross-references and differences (RAF-indexed):
- Uniprot P23843 (1-517)
Domains in SCOPe 2.01: d3tcgh_
Chain 'I':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'J':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'K':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'L':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'M':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'N':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'O':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Chain 'P':
Compound: KGE Peptide
Database cross-references and differences (RAF-indexed):
- PDB 3TCG (0-2)
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3tcgA (A:)
madvpagvtlaekqtlvrnngsevqsldphkiegvpesnisrdlfegllvsdldghpapg
vaeswdnkdakvwtfhlrkdakwsdgtpvtaqdfvyswqrsvdpntaspyasylqyghia
gideilegkkpitdlgvkaiddhtlevtlsepvpyfykllvhpstspvpkaaiekfgekw
tqpgnivtngaytlkdwvvnerivlersptywnnaktvinqvtylpiasevtdvnryrsg
eidmtnnsmpielfqklkkeipdevhvdpylctyyyeinnqkppfndvrvrtalklgmdr
diivnkvkaqgnmpaygytppytdgakltqpewfgwsqekrneeakkllaeagytadkpl
tinllyntsdlhkklaiaasslwkknigvnvklvnqewktfldtrhqgtfdvaragwcad
yneptsflntmlsnssmntahykspafdsimaetlkvtdeaqrtalytkaeqqldkdsai
vpvyyyvnarlvkpwvggytgkdpldntytrnmyivkhhhhhhh