PDB entry 3tbf

View 3tbf on RCSB PDB site
Description: C-terminal domain of glucosamine-fructose-6-phosphate aminotransferase from Francisella tularensis.
Class: transferase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2011-08-05, released 2011-08-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfa_
  • Chain 'B':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfb_
  • Chain 'C':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfc_
  • Chain 'D':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfd_
  • Chain 'E':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfe_
  • Chain 'F':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbff_
  • Chain 'G':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfg_
  • Chain 'H':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0388, glmS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3tbfh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tbfA (A:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfA (A:)
    skdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacgts
    ynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrksk
    kqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviaklk
    nsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaieg
    alklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevharggk
    lilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3tbfB (B:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfB (B:)
    askdgykhymlkeiyeqpeavsntilasladgeisldsakelfektkhicivacgtsyna
    gmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrkskkqn
    yvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviaklknsl
    tdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaiegalk
    lkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevharggklil
    fvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3tbfC (C:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfC (C:)
    askdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacgt
    synagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrks
    kkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviakl
    knsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaie
    galklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevhargg
    klilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3tbfD (D:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfD (D:)
    askdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacgt
    synagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrks
    kkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviakl
    knsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaie
    galklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevhargg
    klilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3tbfE (E:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfE (E:)
    askdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacgt
    synagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrks
    kkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviakl
    knsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaie
    galklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevhargg
    klilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3tbfF (F:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfF (F:)
    askdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacgt
    synagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrks
    kkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviakl
    knsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaie
    galklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevhargg
    klilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3tbfG (G:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfG (G:)
    skdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhicivacgts
    ynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrksk
    kqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviaklk
    nsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaieg
    alklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevharggk
    lilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3tbfH (H:)
    ssssaskdgykhymlkeiyeqpeavsntilasladgeisldsfdkrakelfektkhiciv
    acgtsynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtles
    lrkskkqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlv
    iaklknsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyyp
    iaiegalklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevh
    arggklilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvd
    qprnlaksvtve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tbfH (H:)
    saskdgykhymlkeiyeqpeavsntilasladgeislddkrakelfektkhicivacgts
    ynagmtakywiekyakvpcsveiaseiryrdnvvvdgslfvsisqsgetadtleslrksk
    kqnyvgsmcicnvpnsslvresdiafmtkagveigvastkafttqlvalaiftlviaklk
    nsltdqqiakyteelkniralvmgalkldteidqiseyfsdkehtiflgrglyypiaieg
    alklkeisyihaeaypsgelkhgplalvdknmpivavvpndelldktlsnlqevharggk
    lilfvdkavkervnfdnsivleldaghdfsapvvftiplqllsyhvaiikgtdvdqp