PDB entry 3tb4

View 3tb4 on RCSB PDB site
Description: Crystal structure of the ISC domain of VibB
Class: hydrolase
Keywords: ISC domain, Isochorismatase, HYDROLASE
Deposited on 2011-08-05, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.136
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vibriobactin-specific isochorismatase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_0771, vibB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3tb4a_
  • Heterogens: BOG, PGE, EDO, PEG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3tb4A (A:)
    maipkiasyplpvslptnkvdwridasravllihdmqeyfvhyfdsqaepipslikhiqq
    lkahakqagipvvytaqpanqdpaerallsdfwgpglseetaiiaplapesgdvqltkwr
    ysafkksplldwlretgrdqliitgvyahigilstaldafmfdiqpfvigdgvadfslsd
    hefslryisgrtgavkstqqacleiaaqhskltgllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3tb4A (A:)
    ipkiasyplpvslptnkvdwridasravllihdmqeyfvhyfdsqaepipslikhiqqlk
    ahakqagipvvytaqpanqdpaerallsdfwgpglseetaiiaplapesgdvqltkwrys
    afkksplldwlretgrdqliitgvyahigilstaldafmfdiqpfvigdgvadfslsdhe
    fslryisgrtgavkstqqacleiaa