PDB entry 3tat

View 3tat on RCSB PDB site
Description: tyrosine aminotransferase from e. coli
Deposited on 1998-08-12, released 1999-08-12
The last revision prior to the SCOP 1.71 freeze date was dated 1999-08-12, with a file datestamp of 1999-08-11.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.213
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d3tata_
  • Chain 'B':
    Domains in SCOP 1.71: d3tatb_
  • Chain 'C':
    Domains in SCOP 1.71: d3tatc_
  • Chain 'D':
    Domains in SCOP 1.71: d3tatd_
  • Chain 'E':
    Domains in SCOP 1.71: d3tate_
  • Chain 'F':
    Domains in SCOP 1.71: d3tatf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tatA (A:)
    mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
    hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
    esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
    cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
    vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
    dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
    rlreefgvyliasgrmcvaglntanvqrvakafaavm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tatB (B:)
    mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
    hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
    esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
    cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
    vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
    dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
    rlreefgvyliasgrmcvaglntanvqrvakafaavm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tatC (C:)
    mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
    hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
    esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
    cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
    vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
    dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
    rlreefgvyliasgrmcvaglntanvqrvakafaavm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tatD (D:)
    mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
    hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
    esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
    cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
    vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
    dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
    rlreefgvyliasgrmcvaglntanvqrvakafaavm
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tatE (E:)
    mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
    hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
    esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
    cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
    vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
    dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
    rlreefgvyliasgrmcvaglntanvqrvakafaavm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3tatF (F:)
    mfqkvdayagdpiltlmerfkedprsdkvnlsiglyynedgiipqlqavaeaearlnaqp
    hgaslylpmeglncyrhaiapllfgadhpvlkqqrvatiqtlggsgalkvgadflkryfp
    esgvwvsdptwenhvaifagagfevstypwydeatngvrfndllatlktlparsivllhp
    cchnptgadltndqwdavieilkarelipfldiayqgfgagmeedayairaiasaglpal
    vsnsfskifslygervgglsvmcedaeaagrvlgqlkatvrrnyssppnfgaqvvaavln
    dealkaswlaeveemrtrilamrqelvkvlstempernfdyllnqrgmfsytglsaaqvd
    rlreefgvyliasgrmcvaglntanvqrvakafaavm