PDB entry 3ta6

View 3ta6 on RCSB PDB site
Description: Structure of Mycobacterium tuberculosis triosephosphate isomerase
Class: isomerase
Keywords: isomerase
Deposited on 2011-08-03, released 2011-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.132
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: MT1482, MTCY493.16c, Rv1438, tpi, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ta6a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: MT1482, MTCY493.16c, Rv1438, tpi, tpiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ta6b_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ta6A (A:)
    msrkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgd
    klrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaat
    alkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtg
    rvasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgg
    asldgehfatlaaiaaggplphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ta6A (A:)
    rkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdkl
    rltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaatal
    khgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgrv
    asaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvggas
    ldgehfatlaaiaag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ta6B (B:)
    msrkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgd
    klrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaat
    alkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtg
    rvasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgg
    asldgehfatlaaiaaggplphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ta6B (B:)
    srkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdk
    lrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaata
    lkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgr
    vasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgga
    sldgehfatlaaiaag